Angel1 Antibody - C-terminal region : Biotin

Angel1 Antibody - C-terminal region : Biotin
SKU
AVIARP55224_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of Angel1 remains unknown.

Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: SPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein angel homolog 1

Protein Size: 667

Purification: Affinity Purified
More Information
SKU AVIARP55224_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55224_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 68737
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×