ANGPT4 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Angiopoietins are proteins with important roles in vascular development and angiogenesis. All angiopoietins bind with similar affinity to an endothelial cell-specific tyrosine-protein kinase receptor. The mechanism by which they contribute to angiogenesis

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANGPT4

Key Reference: Nakayama,T., (2007) World J. Gastroenterol. 13 (33), 4473-4479

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: TLVVQHGHCSYTFLLPKSEPCPPGPEVSRDSNTLQRESLANPLHLGKLPT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Angiopoietin-4

Protein Size: 503

Purification: Affinity Purified

• SKU: AVIARP56798_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP56798_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 51378
• Host: Rabbit