ANGPTL2 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Angiopoietins are members of the vascular endothelial growth factor family and the only known growth factors largely specific for vascular endothelium. Angiopoietin-1, angiopoietin-2, and angiopoietin-4 participate in the formation of blood vessels. ANGPTL2 protein is a secreted glycoprotein with homology to the angiopoietins and may exert a function on endothelial cells through autocrine or paracrine action.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ANGL2

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: PPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPPLPTMPTLTSLPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: angiopoietin-related protein 2

Protein Size: 493

Purification: Affinity purified

• SKU: AVIARP54836_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54836_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23452
• Host: Rabbit