ANKMY2 Antibody - N-terminal region : Biotin

ANKMY2 Antibody - N-terminal region : Biotin
SKU
AVIARP57387_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKMY2

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: DVVNSVGRTAAQMAAFVGQHDCVTIINNFFPRERLDYYTKPQGLDKEPKL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat and MYND domain-containing protein 2

Protein Size: 441

Purification: Affinity Purified
More Information
SKU AVIARP57387_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57387_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57037
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×