ANKRD39 Antibody - N-terminal region : Biotin

ANKRD39 Antibody - N-terminal region : Biotin
SKU
AVIARP56912_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of ANKRD39 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD39

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: IWSAALNGDLGRVKHLIQKAEDPSQPDSAGYTALHYASRNGHYAVCQFLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ankyrin repeat domain-containing protein 39

Protein Size: 183

Purification: Affinity Purified
More Information
SKU AVIARP56912_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56912_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51239
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×