ANKRD47 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ANKRD47

Key Reference: Zhu,Y., (2008) Biochim. Biophys. Acta 1780 (2), 128-133

Molecular Weight: 86kDa

Peptide Sequence: Synthetic peptide located within the following region: GPAQLQLVREQMAAALRRLRELEDQARTLPELQEQVRALRAEKARLLAGR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: KN motif and ankyrin repeat domain-containing protein 3

Protein Size: 821

Purification: Affinity Purified

• SKU: AVIARP55872_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55872_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 256949
• Host: Rabbit