Anti-AMN1

antagonist of mitotic exit network 1 homolog, Polyclonal, IgG, Rabbit

GeneName: AMN1

Enhanced Validation: No

Sequence: LTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLVGPNKLKQVTWTVY

Interspecies Mouse/Rat: ENSRNOG00000036917: 85%, ENSMUSG00000068250: 79%

Entrez Gene ID: 196394

UniProt ID: Q8IY45

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000151743

• SKU: ATLHPA062290-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA062290-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 196394
• Host: Rabbit