Anti-ANKFN1

ankyrin repeat and fibronectin type III domain containing 1, Polyclonal, IgG, Rabbit

GeneName: ANKFN1

Enhanced Validation: No

Concentration: 0.1

Sequence: RKPGKHPHHGGFSRHHRWLRIHSETQSLSLSEGIYTQHLSQACGLAQEPKEAKRAGPALDDPRGLTLAHAASLPEERNSSLQDARPSVRRLYVEPYA

Interspecies Mouse/Rat: ENSRNOG00000023532: 74%, ENSMUSG00000047773: 76%

Entrez Gene ID: 162282

UniProt ID: Q8N957

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000153930

• SKU: ATLHPA048953-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA048953-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Human Gene ID: 162282
• Host: Rabbit