Anti-APBB1IP

amyloid beta (A4) precursor protein-binding, family B, member 1 interacting protein, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: APBB1IP

Enhanced Validation: Yes

Concentration: 0.4

Sequence: KTLYDNYQRAVAKAGLASRWTNLGTVNAAAPAQPSTGPKTGTTQPNGQIPQATHSVSAVLQEAQRHAETSKDKKPAL

Interspecies Mouse/Rat: ENSMUSG00000026786: 70%, ENSRNOG00000017803: 65%

Entrez Gene ID: 54518

UniProt ID: Q7Z5R6

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000077420

• SKU: ATLHPA063903-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA063903-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 54518
• Host: Rabbit