Anti-B4GALT4

UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: B4GALT4

Enhanced Validation: No

Concentration: 0.05

Sequence: LQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA

Interspecies Mouse/Rat: ENSRNOG00000003114: 80%, ENSMUSG00000022793: 80%

Entrez Gene ID: 8702

UniProt ID: O60513

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000121578

• SKU: ATLHPA063546-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA063546-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 8702
• Host: Rabbit