Anti-CABLES2

Cdk5 and Abl enzyme substrate 2, Polyclonal, IgG, Rabbit

GeneName: CABLES2

Enhanced Validation: No

Sequence: AKFLYPTNALVTHKSDSHGLLPTPRPSVPRTLPGSRHKPAPTKSAPASTELGSDVGDTLEYNPN

Interspecies Mouse/Rat: ENSMUSG00000038990: 81%, ENSRNOG00000051420: 83%

Entrez Gene ID: 81928

UniProt ID: Q9BTV7

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000149679

• SKU: ATLHPA043597-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA043597-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 81928
• Host: Rabbit