Anti-CFAP99

cilia and flagella associated protein 99, Polyclonal, IgG, Rabbit

GeneName: CFAP99

Enhanced Validation: No

Sequence: RLQFPPRIRKTPKLTFYRPDNILVKLNTTAILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQ

Interspecies Mouse/Rat: ENSMUSG00000109572: 77%, ENSRNOG00000058434: 77%

Entrez Gene ID: 402160

UniProt ID: D6REC4

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000206113

• SKU: ATLHPA071642-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA071642-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 402160
• Host: Rabbit