Anti-GADD45GIP1

growth arrest and DNA-damage-inducible, gamma interacting protein 1, Polyclonal, IgG, Rabbit

GeneName: GADD45GIP1

Enhanced Validation: No

Concentration: 1.1

Sequence: ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER

Interspecies Mouse/Rat: ENSRNOG00000003011: 79%, ENSMUSG00000033751: 74%

Entrez Gene ID: 90480

UniProt ID: Q8TAE8

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000179271

• SKU: ATLHPA065048-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA065048-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 90480
• Host: Rabbit