Anti-JMJD6

jumonji domain containing 6, arginine demethylase and lysine hydroxylase, Polyclonal, IgG, Rabbit

GeneName: JMJD6

Enhanced Validation: No

Sequence: MNHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAAVADNVERADALQLSVEEFVERYERPYKPVVLLNA

Interspecies Mouse/Rat: ENSMUSG00000056962: 93%, ENSRNOG00000000250: 95%

Entrez Gene ID: 23210

UniProt ID: Q6NYC1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000070495

• SKU: ATLHPA074031-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA074031-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 23210
• Host: Rabbit