Anti-KCNH8

potassium voltage-gated channel subfamily H member 8, Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: KCNH8

Enhanced Validation: No

Concentration: 0.4

Sequence: RCISPHSDSTLTPLQSISATLSSSVCSSSETSLHLVLPSRSEEGSFSQGTVSSFSLENLPGSWNQEGMASASTKPLENLPLEVVTSTAEVKDNKA

Interspecies Mouse/Rat: ENSMUSG00000035580: 83%, ENSRNOG00000058626: 86%

Entrez Gene ID: 131096

UniProt ID: Q96L42

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000183960

• SKU: ATLHPA077773-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA077773-100
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Human Gene ID: 131096
• Host: Rabbit
• Conjugate: Unconjugated