Anti-LRRIQ4

leucine rich repeats and IQ motif containing 4, Polyclonal, IgG, Rabbit

GeneName: LRRIQ4

Enhanced Validation: No

Concentration: 0.3

Sequence: TDLKEIPVVIFKNLHHLELLGLTGNHLKCLPKEIVNQTKLREIYLKRNQFEVFPQELCVLYTLEIIDLDENKIGAIPEEIGHLTGLQKFYMASNNL

Interspecies Mouse/Rat: ENSRNOG00000009004: 70%, ENSMUSG00000027703: 71%

Entrez Gene ID: 344657

UniProt ID: A6NIV6

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000188306

• SKU: ATLHPA036271-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA036271-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 344657
• Host: Rabbit