Anti-MCTP1

multiple C2 and transmembrane domain containing 1, Polyclonal, IgG, Rabbit

GeneName: MCTP1

Enhanced Validation: No

Sequence: MLDSCKLKSACNLPFICNKKIINTAGTSNAEVPLADPGMYQLDITLRRGQSLAARDRGGTSD

Interspecies Mouse/Rat: ENSMUSG00000021596: 82%, ENSRNOG00000013282: 63%

Entrez Gene ID: 79772

UniProt ID: Q6DN14

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000175471

• SKU: ATLHPA075887-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA075887-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Western Blotting, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 79772
• Host: Rabbit