Anti-NANOS3

nanos homolog 3 (Drosophila), Polyclonal, IgG, Rabbit

Quote the promo code SZANTIBODY when ordering to receive a 10% discount on this antibody, from October 1st to December 31st 2024. No additional discounts during the promo.

GeneName: NANOS3

Enhanced Validation: Yes

Concentration: 0.3

Sequence: LAHLVRALSGKEGPETRLSPQPEPEPMLEPVSALEPMPAPESVPVPGPKDQKRSLESSPAPERLCSFCKHNG

Interspecies Mouse/Rat: ENSMUSG00000056155: 46%, ENSRNOG00000031593: 46%

UniProt ID: P60323

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000187556

• SKU: ATLHPA062989-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA062989-25
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry
• Isotype: IgG
• Host: Rabbit