Anti-OPG (AbAb01OPG)

Anti-OPG [AbAb01OPG], Monoclonal, IgG1, kappa, Host: Mouse
SKU
ABAAb04113-1.1-BT
Packaging Unit
1 mg
Manufacturer
Absolute Antibody

Availability: loading...
Price is loading...
CloneID: AbAb01OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: O00300
More Information
SKU ABAAb04113-1.1-BT
Manufacturer Absolute Antibody
Manufacturer SKU Ab04113-1.1-BT
Green Labware No
Package Unit 1 mg
Quantity Unit STK
Reactivity Human
Clonality Monoclonal
Application ELISA
Isotype IgG1
Host Mouse
Product information (PDF) Download
MSDS (PDF) Download