Anti-OPG (AbAb01OPG)

Anti-OPG [AbAb01OPG], Monoclonal, IgG, kappa, Host: Rabbit

CloneID: AbAb01OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG N-terminal epitope (MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQ).

Buffer Composition: PBS only.

Concentration: 1 mg/ml

Uniprot Accession No.: O00300

• SKU: ABAAb04113-23.0-BT
• Manufacturer: Absolute Antibody
• Manufacturer SKU: Ab04113-23.0-BT
• Green Labware: No
• Package Unit: 1 mg
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: ELISA
• Isotype: IgG
• Host: Rabbit