Anti-OPG (AbAb02OPG)

Anti-OPG [AbAb02OPG], Monoclonal, IgG, kappa, Host: Rabbit

CloneID: AbAb02OPG

Antigen Long Description: The original antibody was generated by immunizing Balb/c mice with a KLH- (Keyhole Limpet Hemocyanin) coupled synthesized OPG C-terminal epitope (HSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL).

Buffer Composition: PBS with 0.02% Proclin 300.

Concentration: 1 mg/ml

Available Custom Conjugation Options: AP, HRP, Fluorescein, APC, PE, Biotin Type A, Biotin Type B, Streptavidin, FluoroProbes 647H, Atto488, APC/Cy7, PE/Cy7

Uniprot Accession No.: O00300

• SKU: ABAAb04114-23.0
• Manufacturer: Absolute Antibody
• Manufacturer SKU: Ab04114-23.0
• Green Labware: No
• Package Unit: 100 μg
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Monoclonal
• Application: ELISA
• Isotype: IgG
• Host: Rabbit