Anti-RABEPK

Rab9 effector protein with kelch motifs, Polyclonal, IgG, Rabbit

GeneName: RABEPK

Enhanced Validation: No

Sequence: MKQLPVLEPGDKPRKATWYTLTVPGDSPCARVGHSCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLPRYEHASFIPSCTP

Interspecies Mouse/Rat: ENSRNOG00000018591: 82%, ENSMUSG00000070953: 83%

Entrez Gene ID: 10244

UniProt ID: Q7Z6M1

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000136933

• SKU: ATLHPA024415-100
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA024415-100
• Green Labware: No
• Package Unit: 100 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 10244
• Host: Rabbit