Anti-SMARCA1

SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1, Polyclonal, IgG, Rabbit

GeneName: SMARCA1

Enhanced Validation: No

Concentration: 0.6

Sequence: KGEKKKEKNVSSFQLKLAAKAPKSEKEMDPEYEEKMKADRAKRFEFLLKQ

Interspecies Mouse/Rat: ENSMUSG00000031099: 90%, ENSRNOG00000003762: 88%

Entrez Gene ID: 6594

UniProt ID: P28370

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000102038

• SKU: ATLHPA064712-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA064712-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 6594
• Host: Rabbit