Anti-VSIG10

V-set and immunoglobulin domain containing 10, Polyclonal, IgG, Rabbit

GeneName: VSIG10

Enhanced Validation: No

Concentration: 0.3

Sequence: LTCQVSGAYPPAKILWLRNLTQPEVIIQPSSRHLITQDGQNSTLTIHNCSQDLDEGYYICRADSPVGVREMEIWLSVK

Interspecies Mouse/Rat: ENSRNOG00000022698: 74%, ENSMUSG00000066894: 72%

Entrez Gene ID: 54621

UniProt ID: Q8N0Z9

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000176834

• SKU: ATLHPA062022-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA062022-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 54621
• Host: Rabbit