Anti-ZBTB4

zinc finger and BTB domain containing 4, Polyclonal, IgG, Rabbit

GeneName: ZBTB4

Enhanced Validation: No

Concentration: 0.1

Sequence: TPTPVIAYSKGSAGTRPGDVKEEAPQEMQVSSSSGEAGGGSTAAEEASETASLQDPIISGGEEPPVVASGGSYVYPPV

Interspecies Mouse/Rat: ENSMUSG00000018750: 88%, ENSRNOG00000014689: 86%

Entrez Gene ID: 57659

UniProt ID: Q9P1Z0

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Ensembl Gene ID: ENSG00000174282

• SKU: ATLHPA064763-25
• Manufacturer: Atlas Antibodies
• Manufacturer SKU: HPA064763-25
• Green Labware: No
• Package Unit: 25 µl
• Quantity Unit: STK
• Reactivity: Human
• Clonality: Polyclonal
• Application: Immunohistochemistry, Immunocytochemistry
• Isotype: IgG
• Human Gene ID: 57659
• Host: Rabbit