APBB1IP Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: APBB1IP appears to function in the signal transduction from Ras activation to actin cytoskeletal remodeling. APBB1IP suppresses insulin-induced promoter activities through AP1 and SRE. APBB1IP mediates Rap1-induced adhesion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APBB1IP

Molecular Weight: 73kDa

Peptide Sequence: Synthetic peptide located within the following region: LVADISEAEQRTIQAQKESLQNQHHSASLQASIFSGAASLGYGTNVAATG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Amyloid beta A4 precursor protein-binding family B member 1-interacting protein

Protein Size: 666

Purification: Affinity Purified

• SKU: AVIARP57312_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57312_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 54518
• Host: Rabbit