APEX1 Antibody - N-terminal region : HRP

APEX1 Antibody - N-terminal region : HRP
SKU
AVIARP58027_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APEX1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: DNA-(apurinic or apyrimidinic site) lyase

Protein Size: 318

Purification: Affinity Purified
More Information
SKU AVIARP58027_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58027_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 328
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×