APIP Antibody - N-terminal region : HRP

APIP Antibody - N-terminal region : HRP
SKU
AVIARP56788_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: APIP is an APAF1-interacting protein that acts as a negative regulator of ischemic/hypoxic injury.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human APIP

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: AARSDEIYIAPSGVQKERIQPEDMFVCDINEKDISGPSPSKKLKKSQCTP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Probable methylthioribulose-1-phosphate dehydratase

Protein Size: 204

Purification: Affinity Purified
More Information
SKU AVIARP56788_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56788_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51074
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×