APOA2 Antibody - N-terminal region : FITC

APOA2 Antibody - N-terminal region : FITC
SKU
AVIARP54588_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes apolipoprotein (apo-) A-II, which is the second most abundant protein of the high density lipoprotein particles. The protein is found in plasma as a monomer, homodimer, or heterodimer with apolipoprotein D. Defects in this gene may result in apolipoprotein A-II deficiency or hypercholesterolemia.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APOA2

Molecular Weight: 9kDa

Peptide Sequence: Synthetic peptide located within the following region: MKLLAATVLLLTICSLEGALVRRQAKEPCVESLVSQYFQTVTDYGKDLME

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein A-II

Protein Size: 100

Purification: Affinity Purified
More Information
SKU AVIARP54588_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54588_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 336
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×