APOL5 Antibody - C-terminal region : FITC

APOL5 Antibody - C-terminal region : FITC
SKU
AVIARP58857_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human APOL5

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: QHHRHLPQKASQTCSSSRGRAVRGSRVVKPEGSRSPLPWPVVEHQPRLGP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Apolipoprotein L5

Protein Size: 433

Purification: Affinity Purified
More Information
SKU AVIARP58857_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58857_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 80831
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×