ARAF Antibody - middle region : HRP

ARAF Antibody - middle region : HRP
SKU
AVIARP54592_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARAF

Key Reference: Razzaque,M.A., (2007) Nat. Genet. 39 (8), 1013-1017

Molecular Weight: 67kDa

Peptide Sequence: Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein kinase A-Raf

Protein Size: 606

Purification: Affinity Purified
More Information
SKU AVIARP54592_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54592_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 369
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×