ARFIP1 Antibody - C-terminal region : Biotin

Conjugation: Biotin

Description of Target: ARFIP1 is a putative target protein of ADP-ribosylation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARFIP1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arfaptin-1

Protein Size: 373

Purification: Affinity Purified

• SKU: AVIARP54460_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54460_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 27236
• Host: Rabbit