ARFIP1 Antibody - C-terminal region : HRP

ARFIP1 Antibody - C-terminal region : HRP
SKU
AVIARP54460_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARFIP1 is a putative target protein of ADP-ribosylation factor.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ARFIP1

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: NKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLKTPGVDAPSWL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Arfaptin-1

Protein Size: 373

Purification: Affinity Purified
More Information
SKU AVIARP54460_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54460_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 27236
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×