ARFIP2 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARFIP2 is a putative target protein of ADP-ribosylation factor. It is involved in membrane ruffling.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ARFIP2

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: CTKQLLSERFGRGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arfaptin-2

Protein Size: 256

Purification: Affinity Purified

• SKU: AVIARP54459_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54459_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 23647
• Host: Rabbit