ARHGAP1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARHGAP1 is a GTPase activator for the Rho, Rac and Cdc42 proteins, converting them to the putatively inactive GDP-bound state. Cdc42 seems to be the preferred substrate.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP1

Molecular Weight: 50kDa

Peptide Sequence: Synthetic peptide located within the following region: MDPLSELQDDLTLDDTSEALNQLKLASIDEKNWPSDEMPDFPKSDDSKSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 1

Protein Size: 439

Purification: Affinity Purified

• SKU: AVIARP54722_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54722_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 392
• Host: Rabbit