ARHGAP15 Antibody - middle region : Biotin

ARHGAP15 Antibody - middle region : Biotin
SKU
AVIARP57261_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: LLSHYDSDIKEQKPEHRKSLMFRLHHSASDTSDKNRVKSRLKKFITRRPS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 15

Protein Size: 475

Purification: Affinity Purified
More Information
SKU AVIARP57261_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57261_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55843
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×