ARHGAP15 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: RHO GTPases (see ARHA; MIM 165390) regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15 (Seoh et al., 2003 [PubMed 12650940]).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP15

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 15

Protein Size: 475

Purification: Affinity Purified

• SKU: AVIARP57262_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57262_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55843
• Host: Rabbit