ARHGAP20 Antibody - middle region : Biotin

ARHGAP20 Antibody - middle region : Biotin
SKU
AVIARP57460_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ARHGAP20 is an GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP20

Molecular Weight: 132kDa

Peptide Sequence: Synthetic peptide located within the following region: YSSLSSPGTSPSGSSVSSQDSAFSQISEHSVFTPTETSSPIDCTFQAQRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 20

Protein Size: 1191

Purification: Affinity Purified
More Information
SKU AVIARP57460_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57460_P050-Biotin
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57569
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×