ARHGAP25 Antibody - middle region : Biotin

ARHGAP25 Antibody - middle region : Biotin
SKU
AVIARP58423_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: ARHGAPs, such as ARHGAP25, are negative regulators of Rho GTPases, which are implicated in actin remodeling, cell polarity, and cell migration.ARHGAPs, such as ARHGAP25, encode negative regulators of Rho GTPases (see ARHA; MIM 165390), which are implicated in actin remodeling, cell polarity, and cell migration (Katoh and Katoh, 2004 [PubMed 15254788]).[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARHGAP25

Key Reference: Katoh,M. (2004) Int. J. Mol. Med. 14 (2), 333-338

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Rho GTPase-activating protein 25

Protein Size: 638

Purification: Affinity Purified
More Information
SKU AVIARP58423_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58423_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9938
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×