ARHGAP30 Antibody - N-terminal region : HRP

ARHGAP30 Antibody - N-terminal region : HRP
SKU
AVIARP54462_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARHGAP30 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARHGAP30

Molecular Weight: 98kDa

Peptide Sequence: Synthetic peptide located within the following region: RKWRSIFNLGRSGHETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Rho GTPase-activating protein 30

Protein Size: 890

Purification: Affinity Purified
More Information
SKU AVIARP54462_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54462_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 257106
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×