ARIH2 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARIH2 is the E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. 'ARIH2 may play a role in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARIH2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 ubiquitin-protein ligase ARIH2

Protein Size: 493

Purification: Affinity Purified

• SKU: AVIARP57935_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57935_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 10425
• Host: Rabbit