ARIH2 Antibody - N-terminal region : HRP

ARIH2 Antibody - N-terminal region : HRP
SKU
AVIARP57935_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARIH2 is the E3 ubiquitin-protein ligase mediating 'Lys-48'-and 'Lys-63'-linked polyubiquitination and subsequent proteasomal degradation of modified proteins. 'ARIH2 may play a role in myelopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARIH2

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVDMNSQGSDSNEEDYDPNCEEEEEEEEDDPGDIEDYYVGVASDVEQQG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: E3 ubiquitin-protein ligase ARIH2

Protein Size: 493

Purification: Affinity Purified
More Information
SKU AVIARP57935_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57935_P050-HRP
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10425
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×