ARL5A Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: ARL5A lacks ADP-ribosylation enhancing activity.The protein encoded by this gene belongs to the ARF family of GTP-binding proteins. With its distinctive nuclear/nucleolar localization and interaction with HP1alpha, the protein is developmentally regulated and may play a role(s) in nuclear dynamics and/or signaling cascades during embryonic development. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL5A

Key Reference: Wang,Z.X., (2005) Biochem. Biophys. Res. Commun. 332 (3), 640-645

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: YKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: ADP-ribosylation factor-like protein 5A

Protein Size: 179

Purification: Affinity Purified

• SKU: AVIARP55757_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55757_P050-FITC
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Goat (Caprine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 26225
• Host: Rabbit