ARL8B Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ARL8B may play a role in lysosome motility and chromosome segregation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARL8B

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: SRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDRE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: ADP-ribosylation factor-like protein 8B

Protein Size: 186

Purification: Affinity Purified

• SKU: AVIARP57138_P050-HRP
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57138_P050-HRP
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 55207
• Host: Rabbit