ARMC3 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The specific function of ARMC3 is not yet known.Armadillo/beta-catenin (CTNNB1; MIM 116806)-like (ARM) domains are imperfect 45-amino acid repeats involved in protein-protein interactions. ARM domain-containing proteins, such as ARMC3, function in signal transduction, development, cell adhesion and mobility, and tumor initiation and metastasis (Li et al., 2006 [PubMed 16915934]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-6 DB459427.1 2-7 7-1959 BC039312.1 1-1953 1960-2806 AK098711.1 501-1347 2807-2837 BC039312.1 2801-2831

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARMC3

Key Reference: Li,X., (2006) Genetika 42 (7), 999-1003

Molecular Weight: 96kDa

Peptide Sequence: Synthetic peptide located within the following region: YHFSAGFGSPIEDKSEPASGRNTVLSKSATKEKGWRKSKGKKEEEKVKEE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Armadillo repeat-containing protein 3

Protein Size: 872

Purification: Affinity Purified

• SKU: AVIARP55626_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP55626_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 219681
• Host: Rabbit