ARSA Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: ARSA hydrolyzes cerebroside sulfate. Defects in ARSA are a cause of leukodystrophy metachromatic (MLD).The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ARSA

Key Reference: Saito,S., (2008) Mol. Genet. Metab. 93 (4), 419-425

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arylsulfatase A

Protein Size: 507

Purification: Affinity Purified

• SKU: AVIARP54528_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP54528_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 410
• Host: Rabbit