Arsb Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: TDNGGQTRSGGNNWPLRGRKGTLWEGGIRGTGFVASPLLKQKGVKSRELM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Arylsulfatase B

Protein Size: 534

Purification: Affinity Purified

• SKU: AVIARP58861_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP58861_P050-Biotin
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 11881
• Host: Rabbit
• Conjugate: Conjugated, Biotin