ASAH1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally. The encoded protein catalyzes the synthesis and degradation of ceramide into

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASAH1

Key Reference: Kim,H.L. (2008) Genetics 178 (3), 1505-1515

Molecular Weight: 44kDa

Peptide Sequence: Synthetic peptide located within the following region: MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acid ceramidase

Protein Size: 395

Purification: Affinity Purified

• SKU: AVIARP57760_P050-Btn
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP57760_P050-Biotin
• Green Labware: No
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 427
• Host: Rabbit