ASF1A Antibody - N-terminal region : FITC

ASF1A Antibody - N-terminal region : FITC
SKU
AVIARP58260_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASF1A

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone chaperone ASF1A

Protein Size: 204

Purification: Affinity Purified
More Information
SKU AVIARP58260_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58260_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25842
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×