ASPDH Antibody - N-terminal region : FITC

ASPDH Antibody - N-terminal region : FITC
SKU
AVIARP56221_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LOC554235

Key Reference: Strausberg,R.L., (2002) Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: VVEVAHPKIIHESGAQILRHANLLVGSPSALSDQTTERQLLEASQHWDHA

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative L-aspartate dehydrogenase

Protein Size: 283

Purification: Affinity Purified
More Information
SKU AVIARP56221_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56221_P050-FITC
Green Labware No
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 554235
Host Rabbit
Product information (PDF) Download
MSDS (PDF)
×